Cerrado

Neuro fuzzy systems

I need someone to design a neurofuzzy system for protein secondary structure prediction. Given a protein sequence it should output the secondary sequence of that protein sequence

For example if the protein sequence is KSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG the secondary structure should be CCCHHHCCCCHHHHHHHHHHHCCCCEEEEEECCCCEECCCCCCEEEEEEECCCCEECCCCEEC.

Habilidades: Biotecnología, Mathlab y Mathematica, Ingeniería de telecomunicaciones

Ver más: neuro linguistic programming example, write proposal work example, general contract services example, cover page resume example, contract services example, contract service example, sharp neuro fuzzy, neuro fuzzy system using, neuro fuzzy matlab mathematica, fuzzy neuro forecasting economic, forex code neuro fuzzy, php output example, neuro fuzzy, neuro fuzzy forex, implement systems organisation, reverse auction feedback systems, flash ordering systems, online cinema booking systems, turnkey itsp systems, miniproject communication systems, online testing systems free

Información del empleador:
( 1 comentario ) Dover, United States

ID de proyecto: #11760381

11 los freelancers están ofertando un promedio de $287 para este trabajo.

kjgroup197318

----------Best Result on Time! Pro Algorithm and Matlab Expert! No Problem!-------------- Hello, dear! I'm interesting of your project because I'm expert of Algorithm and Matlab so that I have some good Experience Más

$200 USD en 3 días
(162 comentarios)
6.7
aminariaz

sir i can help u with this project i have done masters in computer engg with specilization in image processing and pattern recognition this is a dummy bid i can give u an exact estimate after we discuss the project hop Más

$155 USD en 3 días
(68 comentarios)
5.7
zain437

Hi i can help you in this project. I have done projects on fuzzy logic. kindly share some more details so that i can further guide you. Thanks for considering my bid.

$222 USD en 7 días
(14 comentarios)
4.8
chyconsl

Hi, I have read and understood the project description and possess the skills required to meet your needs. Please give me a chance and reply. Thanks.

$833 USD en 10 días
(4 comentarios)
3.9
sahanwa23

Hi! Im an electrical and electronic masters student studying in UWE. I have the experience of programming in C/C++/Assembly/Arduino/PIC C/MikroC/MATLAB for more than three years. I also have the knowledge and experie Más

$135 USD en 2 días
(9 comentarios)
3.7
smartresearch1

I am an expert in data mining and predictive modeling. I have a PhD in Physics and I have extensive experience in machine learning applications, statistics and software development (web, mobile, desktop, SaaS). I work Más

$800 USD en 12 días
(2 comentarios)
2.4
lingung525

Hi, I am an expert in Matlab. I have much experience in Neuro fuzzy system. I can do that perfectly.

$155 USD en 3 días
(4 comentarios)
2.3
pirouzbehrooz

I have M.Sc. in engineering and more than 10 years of experience as an engineer and researcher. More than 40 papers, seven books, and one standard. In my profile, I attached some of my papers and books and samples of m Más

$200 USD en 7 días
(1 comentario)
2.0
amariitism

Dear Sir I am pursuing PhD in CSE, I have deep understanding of the domain. I am new to this community and willing to contribute to the society. With you kind consideration and permission, I would like to do th Más

$150 USD en 3 días
(1 comentario)
1.3
hemantmayatra

Published 2 IEEE papers on endoscopic image restoration technique. 4 research papers pending for approval. [url removed, login to view] [url removed, login to view] Más

$200 USD en 3 días
(1 comentario)
1.0
nigamkumar09

Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Pro Más

$155 USD en 3 días
(0 comentarios)
0.0
nitulsodlan1702

Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Pro Más

$155 USD en 3 días
(0 comentarios)
0.0